PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10018547
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 256aa    MW: 29453.3 Da    PI: 4.856
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10018547genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.25.8e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT +Ed +l+ +v ++G ++W++ +r  g+ R++k+c++rw++yl
      Lus10018547 14 KGTWTRDEDVKLAAYVSRYGCRNWRRLPRDAGLARCGKSCRLRWLNYL 61
                     799*******************************************97 PP

2Myb_DNA-binding58.41.6e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE+  +v ++++lG++ W+ Ia +m+ gRt++++k++w+++l
      Lus10018547  67 RGNFTQEEEAAIVSLHEKLGNK-WSVIATYMP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.457961IPR017930Myb domain
SuperFamilySSF466891.8E-2911108IPR009057Homeodomain-like
SMARTSM007177.0E-101363IPR001005SANT/Myb domain
PfamPF002493.1E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-221568IPR009057Homeodomain-like
CDDcd001674.41E-81661No hitNo description
PROSITE profilePS5129426.83362116IPR017930Myb domain
SMARTSM007172.4E-1766114IPR001005SANT/Myb domain
PfamPF002491.1E-1667112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2669114IPR009057Homeodomain-like
CDDcd001677.75E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MARTPYVDRN GLKKGTWTRD EDVKLAAYVS RYGCRNWRRL PRDAGLARCG KSCRLRWLNY  60
LRPDIKRGNF TQEEEAAIVS LHEKLGNKWS VIATYMPGRT DNEIKNFWNT HLKRLQPKEE  120
PLESNVSDEN DRHVLLGSNF GAGIKNEFSD FDEISSWIEN YNEDINHAAI EVSVSPHDLD  180
HYSPDHHMSV GSNSSSNSET EMATTAVASN DELGDLISDY ILSQPFSTYE EVDQYDTWWS  240
EVWRTSTNTD QFQYI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-27121145106B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35633186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.12e-55MYB-like 102